Workybooks

Communication Components Game

Premium Resource
Grades
1
2
3
4
5
PRINT+DIGITAL RESOURCE
This learning resource is available in interactive and printable formats. The interactive worksshet can be played online and assigned to students. The Printable PDF version can be downloaded and printed for completion by hand.

Sort these items based on whether they are materials, energy sources, or parts commonly found in communication devices.

MaterialEnergy SourceDevice Partwireplastic cupmirrorbatterysolar panelflashlightspeakerswitchmicrophonebulbLED
ABOUT THIS GAME
In this word sort activity, 'Communication Components,' students explore the essential components and materials needed in devices that communicate through light or sound. Designed for NGSS standard 1-PS4-4, this activity introduces first-grade students to concepts like energy sources, materials, and parts essential for building communication devices. Students are prompted to categorize various items into 'Material,' 'Energy Source,' and 'Device Part' to understand the function each component serves in transmitting messages over a distance. By sorting items like 'battery,' 'speaker,' and 'flashlight,' students gain a foundational understanding of communication technologies and learn the importance of each part's role in creating sound or light-based messaging tools. This engaging activity supports NGSS standards in a fun, interactive way, providing hands-on learning that encourages young scientists to think critically about communication technology.
Publisher:
Workybooks
Written by:
Workybooks Team
Illustrated by:
RELATED TAGS
communication components
1st-grade science
NGSS 1-PS4-4
sound communication
light communication
energy sources

Related Resources

interactive | printable worksheet on CCSS W.5.4 - Simple Machines Science Report - thumbnail
Simple Machines Science Report
This science writing task requires students to clearly explain how three simple machines work using precise domain-speci...
W.5.4
interactive | printable worksheet on CCSS L.3.6,L.3.4.A - Science Vocabulary - thumbnail
Science Vocabulary
This worksheet on domain-specific words will help students learn some science vocabulary. Students will be asked to matc...
L.3.6L.3.4.A
interactive | printable worksheet on CCSS K-PS3-1,RL.1.1 - Beach Day Science - thumbnail
Beach Day Science
This passage addresses NGSS K-PS3-1 by comparing temperature differences in materials exposed to sunlight versus shade. ...
K-PS3-1RL.1.1
interactive | printable worksheet on CCSS RI.2.7,RI.2.10,RF.2.4,RF.2.4.A - Analyzing Visual information—Parts of an Insect - thumbnail
Analyzing Visual information—Parts of an Insect
This informational text about the parts of an insect is a great opportunity to practice interacting with images in a tex...
RI.2.7RI.2.10RF.2.4RF.2.4.A
interactive | printable worksheet on CCSS RI.2.4,RI.2.10,RI.3.4,RI.3.10 - Informational Text — Astronauts - thumbnail
Informational Text — Astronauts
Practice this second grade context clues worksheet with this informational text on astronauts. Students will read the te...
RI.2.4RI.2.10RI.3.4RI.3.10
interactive | printable worksheet on CCSS RI.2.4,RI.2.10,RI.3.4,RI.3.10 - Informational Text —Sea Stars - thumbnail
Informational Text —Sea Stars
Use this second grade worksheet on context clues with this informational text on sea stars. Students will read the text ...
RI.2.4RI.2.10RI.3.4RI.3.10
interactive | printable worksheet on CCSS RF.3.4.A - Informational Text — Habitats - thumbnail
Informational Text — Habitats
This short informational text on habitats will teach your students what a habitat is, as well as provide some examples o...
RF.3.4.A
interactive | printable worksheet on CCSS RI.1.7,RI.10,RF.1.4.A,RF.1.4 - Interpreting visual information on Layers of the Earth - thumbnail
Interpreting visual information on Layers of the Earth
This informational text on the layers of the earth is a great way to practice using images during reading. Students will...
RI.1.7RI.10RF.1.4.ARF.1.4
interactive | printable worksheet on CCSS RI.2.7,RI.2.10,RI.2.1,RF.2.4.A,RF.2.4 - Analyze Visual information—The Arctic Fox - thumbnail
Analyze Visual information—The Arctic Fox
This informational text about arctic foxes is a great opportunity to practice interacting with images in a text. Student...
RI.2.7RI.2.10RI.2.1RF.2.4.A
interactive | printable worksheet on CCSS RI.4.5 - Informational Text —Importance of Sound - thumbnail
Informational Text —Importance of Sound
This Reading Informational Text Common Core standards calls for 4th graders to be able to effectively describe and analy...
RI.4.5
interactive | printable worksheet on CCSS RI.4.1,ESS3B,W.4.7,RF.4.4 - Earthquake and buildings - thumbnail
Earthquake and buildings
Download this worksheet on the impact of earthquakes on buildings. The informational text included in this worksheet is ...
RI.4.1ESS3BW.4.7RF.4.4
interactive | printable worksheet on CCSS RI.3.10,RF.3.4,RF.3.4.A,RI.3.1 - Informational Text —Bioluminescence - thumbnail
Informational Text —Bioluminescence
This informational text on bioluminescence will teach your students about this phenomenon. Examples in nature are provid...
RI.3.10RF.3.4RF.3.4.ARI.3.1
interactive | printable worksheet on CCSS RL.4.1,RL.5.1,RL.6.1 - The Science Project—Making Inference - thumbnail
The Science Project—Making Inference
This reading passage titled "The Science Project" helps 4th grade students practice both explicit detail recognition and...
RL.4.1RL.5.1RL.6.1
interactive | printable worksheet on CCSS RL.4.1,RL.5.1,RL.6.1 - The Science Competition - thumbnail
The Science Competition
This reading passage titled "The Science Competition" supports 5th grade students in developing their ability to quote a...
RL.4.1RL.5.1RL.6.1
interactive | printable worksheet on CCSS RI.3.10,RF.3.4,RF.3.4.A,RI.3.1,RI.3.7 - Informational Text —Snowflakes - thumbnail
Informational Text —Snowflakes
This informational text on snowflakes will teach your students how snowflakes are formed. Images of several different fl...
RI.3.10RF.3.4RF.3.4.ARI.3.1
interactive | printable worksheet on CCSS RI.3.10,RF.3.4,RF.3.4.A,RI.3.1,RF.2.4,RF.2.4.A - Informational Text — Cloud Gazing - thumbnail
Informational Text — Cloud Gazing
This informational text teaches students how different types of clouds are formed. A page with pictures of the different...
RI.3.10RF.3.4RF.3.4.ARI.3.1
interactive | printable worksheet on CCSS RI.1.7,RI.10,RF.1.4.A,RF.1.4 - Informational Text on Parts of a Tree - thumbnail
Informational Text on Parts of a Tree
This informational text on the parts of a tree is a great way to practice using images during reading. Students will rea...
RI.1.7RI.10RF.1.4.ARF.1.4
interactive | printable worksheet on CCSS RF.3.4.A - Informational Text —Uh Oh, Where Did Gravity Go? - thumbnail
Informational Text —Uh Oh, Where Did Gravity Go?
This short informational text on gravity will teach your students about this natural phenomenon. A fun drawing activity ...
RF.3.4.A
interactive | printable worksheet on CCSS W.4.2.E - The Benefits of Physical Activity - thumbnail
The Benefits of Physical Activity
W.4.2.E
Copyright © 2025 Workybooks. Made with ♥ in California.