Workybooks

Human Needs and Places Game

Premium Resource
Grades
K
1
2
PRINT+DIGITAL RESOURCE
This learning resource is available in interactive and printable formats. The interactive worksshet can be played online and assigned to students. The Printable PDF version can be downloaded and printed for completion by hand.

Sort these human activities based on where people do them to meet their needs.

Land-Based ActivitiesWater-Based Activitiesfarminggardeningcookingminingforestrybuildinghikingharvestingfishingswimmingboatingtraveling
ABOUT THIS GAME
This NGSS K-ESS3-1-aligned word sort activity helps kindergarteners explore human activities and their environmental relationships. In 'Human Needs and Places,' students categorize actions as either 'Land-Based Activities' or 'Water-Based Activities,' sorting words like 'farming,' 'fishing,' and 'mining.' This engaging word sort fosters awareness of human-environment interactions, teaching young learners how people adapt their activities to meet needs based on the surrounding environment. A practical, vocabulary-rich activity that introduces early environmental science concepts.
Publisher:
Workybooks
Written by:
Workybooks Team
Illustrated by:
RELATED TAGS
human activities
kindergarten science
NGSS K-ESS3-1
human needs
environmental adaptation
word sort

Related Resources

interactive | printable worksheet on CCSS L.3.6,L.3.4.A - Science Vocabulary - thumbnail
Science Vocabulary
This worksheet on domain-specific words will help students learn some science vocabulary. Students will be asked to matc...
L.3.6L.3.4.A
interactive | printable worksheet on CCSS  - Plants in Different Environments - thumbnail
interactive
Plants in Different Environments
Aligned with NGSS K-ESS3-1, this activity introduces kindergarteners to the connection between plants and their environm...
interactive | printable worksheet on CCSS W.5.4 - Simple Machines Science Report - thumbnail
Simple Machines Science Report
This science writing task requires students to clearly explain how three simple machines work using precise domain-speci...
W.5.4
interactive | printable worksheet on CCSS  - How Plants Affect Their Environment - thumbnail
interactive
How Plants Affect Their Environment
This activity for kindergarten aligns with NGSS K-ESS2-2, helping students explore how plants impact their environment. ...
interactive | printable worksheet on CCSS  - Earth's Gifts - thumbnail
Earth's Gifts
This passage explores how humans and other living things use Earth's natural resources. Students discover how various na...
interactive | printable worksheet on CCSS 4-ESS3-1 - Environmental Impact Word Sort" - thumbnail
interactive
Environmental Impact Word Sort"
This classification activity helps students understand environmental impacts of energy use. Students categorize various ...
4-ESS3-1
interactive | printable worksheet on CCSS RL.3.1,RL.2.1,RL.4.9 - The Space Garden - thumbnail
The Space Garden
This innovative passage combines plant science with space exploration, aligning with NGSS standards for life sciences an...
RL.3.1RL.2.1RL.4.9
interactive | printable worksheet on CCSS RI.4.4,RI.4.2 - Exploring Space: Rockets and Spacecraft - thumbnail
Exploring Space: Rockets and Spacecraft
Space exploration has been one of humanity's greatest achievements, made possible by rockets and spacecraft. Rockets act...
RI.4.4RI.4.2
interactive | printable worksheet on CCSS  - How Humans Modify Their Environment - thumbnail
interactive
How Humans Modify Their Environment
This NGSS-aligned word sort activity, designed for kindergarten, explores ways humans change the environment to meet the...
interactive | printable worksheet on CCSS  - Earth Changes Word Sort - thumbnail
interactive
Earth Changes Word Sort
This word sort activity helps students understand different rates of change in Earth's systems. Students classify 12 geo...
interactive | printable worksheet on CCSS K-PS3-1,RL.1.1 - Beach Day Science - thumbnail
Beach Day Science
This passage addresses NGSS K-PS3-1 by comparing temperature differences in materials exposed to sunlight versus shade. ...
K-PS3-1RL.1.1
interactive | printable worksheet on CCSS  - Earth's Quick and Slow Changes - thumbnail
interactive
Earth's Quick and Slow Changes
In 'Earth's Quick and Slow Changes,' students categorize 12 Earth events by their speed of occurrence, enhancing underst...
interactive | printable worksheet on CCSS  - How Animals Change Their Environment - thumbnail
interactive
How Animals Change Their Environment
This kindergarten-level activity aligns with NGSS K-ESS2-2, where students explore how animals modify their environment ...
interactive | printable worksheet on CCSS  - The Gaia Hypothesis - thumbnail
The Gaia Hypothesis
The Gaia Hypothesis, proposed by James Lovelock, suggests that Earth functions like a living organism, with all its part...
interactive | printable worksheet on CCSS L.K.1.B,L.1.1.E,L.2.1.D,L.3.1.A,L.4.1.B,L.5.1.B - Earth Day Environment Word Search - thumbnail
interactive
Earth Day Environment Word Search
Word search on Earth Day Environment Word Search! Vocabulary practice aligned to Common Core standards!
L.K.1.BL.1.1.EL.2.1.DL.3.1.A
interactive | printable worksheet on CCSS MS-ESS3-2,MS-ESS2-3,RST.6-8.2 - All About Seismometers - thumbnail
All About Seismometers
This informational science passage explores seismometers and their role in measuring earthquakes, designed specifically ...
MS-ESS3-2MS-ESS2-3RST.6-8.2
interactive | printable worksheet on CCSS  - City of Arts and Sciences - thumbnail
City of Arts and Sciences
This City of Arts and Sciences coloring page introduces kidss to one of Spain's most striking modern architectural complexes. The illustration captures the futuristic design of the complex, featuring ...
interactive | printable worksheet on CCSS RI.1.7,RI.10,RF.1.4.A,RF.1.4 - Interpreting visual information on Layers of the Earth - thumbnail
Interpreting visual information on Layers of the Earth
This informational text on the layers of the earth is a great way to practice using images during reading. Students will...
RI.1.7RI.10RF.1.4.ARF.1.4
interactive | printable worksheet on CCSS RI.4.1,RI.4.2,ESS3.C,ESS3.A - Earth and Recycling Initiatives - thumbnail
Earth and Recycling Initiatives
RI.4.1RI.4.2ESS3.CESS3.A
Copyright © 2025 Workybooks. Made with ♥ in California.